The CRA domain within your query sequence starts at position 596 and ends at position 698, and its E-value is 1.6e-24.

AAIERMIHFGRELQAMSEQLRRECGKNTANKKMLKDAFSLLAYSDPWNSPVGNQLDPIQREPVCSALNSAILETHNLPKQPPLALAMGQATQCLGLMARSGVG
CRA

CRA

CT11-RanBPM
SMART ACC:SM000757
Description:protein-protein interaction domain present in crown eukaryotes (plants, animals, fungi)
InterPro ACC:IPR013144
InterPro abstract:

This entry represents the CRA (or CT11-RanBPM) domain, which is a protein-protein interaction domain present in crown eukaryotes (plants, animals, fungi) and which is found in Ran-binding proteins such as Ran-binding protein 9 (RanBP9 or RanBPM) and RanBP10. RanBPM is a scaffolding protein important in regulating cellular function in both the immune system and the nervous system, and may act … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 5 980 CRA domains in 5 977 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing CRA domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing CRA domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Interaction (with the environment)

Relevant references for this domain

Primary literature for the CRA domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a CRA domain which could be assigned to a KEGG orthologous group, and not all proteins containing CRA domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR013144