The LamNT domain within your query sequence starts at position 20 and ends at position 244, and its E-value is 2.9e-80.

ACSRGACYPPVGDLLIGRTQLLRASSTCGLTKPETYCTQYGQWQMKCCKCDSRLPRNYNSHRVENVASSSGPMRWWQSQNDVSPVSLQLDLDKRMQLQDIMMDFKGLTPAGMLIERSSDFGKTWRVYQYLATDCASTFPQVHQGQPKNWQDVRCRPLSQRPNGHLTGGKVQLNLMDLASAIPASQSKKIQELGDITNLRVNFTKLAPVPQRGSYPPSAYFAVSQL
LamNT

LamNT

Laminin N-terminal domain (domain VI)
SMART ACC:SM000136
Description:N-terminal domain of laminins and laminin-related protein such as Unc-6/ netrins.
InterPro ACC:IPR008211
InterPro abstract:

Laminin is a large molecular weight glycoprotein present only in basement membranes in almost every animal tissue. It is thought to mediate the attachment, migration and organisation of cells into tissues during embryonic development by interacting with other extracellular matrix components [ PUBMED:1975589 ]. Each laminin … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 8 957 LamNT domains in 8 947 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing LamNT domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing LamNT domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the LamNT domain is listed below. Automatically-derived, secondary literature is also available.

Disease genes where sequence variants are found in this domain

UniRef sequences and OMIM curated human diseases associated with missense mutations within the LamNT domain.

ProteinDescriptionDisease / phenotype
LAMB3_HUMANOMIM:150310 : Epidermolysis bullosa, Herlitz junctional type
OMIM:226700 : Epidermolysis bullosa, generalized atrophic benign
OMIM:226650 : no description

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a LamNT domain which could be assigned to a KEGG orthologous group, and not all proteins containing LamNT domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR008211
Pfamlaminin_Nterm