The DM14 domain within your query sequence starts at position 278 and ends at position 335, and its E-value is 5.07e-24.

ALLLARQREYKAAALDAKRAGDLDRARELMRIGKRFGTVLEALEKGQPVDLSGMPPAP
DM14

DM14

Repeats in fly CG4713, worm Y37H9A.3 and human FLJ20241.
SMART ACC:SM000685
Description: -
InterPro ACC:IPR006608
InterPro abstract:

This is a short helical domain found in multiple copies in most members of this entry. In CC2D1A/B proteins is present four times. Its function is not yet known [ PUBMED:20529849 ].

This entry includes coiled-coil and C2 domain-containing protein 1A/B (CC2D1A/B, also known as Freud-1/2). CC2D1A is involved … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 3 682 DM14 domains in 975 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing DM14 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing DM14 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR006608