The ETS domain within your query sequence starts at position 341 and ends at position 426, and its E-value is 2.4e-56.

ALQLWQFLVALLDDPTNAHFIAWTGRGMEFKLIEPEEVARLWGIQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFVCEPE
ETS

ETS

erythroblast transformation specific domain
SMART ACC:SM000413
Description:variation of the helix-turn-helix motif
InterPro ACC:IPR000418
InterPro abstract:

Transcription factors are protein molecules that bind to specific DNA sequences in the genome, resulting in the induction or inhibition of gene transcription [ PUBMED:2163347 ]. The ets oncogene is such a factor, possessing a region of 85-90 amino acids known as the ETS (erythroblast transformation specific) domain [ … expand

GO process:regulation of DNA-templated transcription (GO:0006355)
GO function:sequence-specific DNA binding (GO:0043565), DNA-binding transcription factor activity (GO:0003700)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 14 302 ETS domains in 14 280 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing ETS domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing ETS domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Binding / catalysis:DNA-binding

Relevant references for this domain

Primary literature for the ETS domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a ETS domain which could be assigned to a KEGG orthologous group, and not all proteins containing ETS domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamEts
InterProIPR000418
PROSITEETS_DOMAIN_2