The GluR_Homer-bdg domain within your query sequence starts at position 1121 and ends at position 1171, and its E-value is 1.42e-24.

ALTPPSPFRDSVDSGSTTPNSPVSESALCIPSSPKYDTLIIRDYTQSSSSL
GluR_Homer-bdg

GluR_Homer-bdg

SMART ACC:SM001229
Description:This is the proline-rich region of metabotropic glutamate receptor proteins that binds Homer-related synaptic proteins. The Homer proteins form a physical tether linking mGluRs with the inositol trisphosphate receptors (IP3R) that appears to be due to the proline-rich "Homer ligand" (PPXXFr). Activation of PI turnover triggers intracellular calcium release (PMID:9808459). MGluR function is altered in the mouse model of human Fragile X syndrome mental retardation, a disorder caused by loss of function mutations in the Fragile X mental retardation gene Fmr1. Homer 3 (and to a lesser extent Homer 1b/c) has been shown to form a multimeric complex with mGlu1a and the IP3 receptor, indicating that Homers may play a role in the localisation of receptors to their signalling partners (PMID:18184796)
InterPro ACC:IPR019588
InterPro abstract:

This entry represents the proline-rich region of metabotropic glutamate receptor proteins that bind Homer-related synaptic proteins.

Metabotropic glutamate receptors function as receptors for glutamate. The activity of this receptor is mediated by a G-protein that activates a phosphatidylinositol-calcium second messenger system.

The Homer proteins form a physical tether linking … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 778 GluR_Homer-bdg domains in 778 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing GluR_Homer-bdg domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing GluR_Homer-bdg domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Signalling

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a GluR_Homer-bdg domain which could be assigned to a KEGG orthologous group, and not all proteins containing GluR_Homer-bdg domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

Links to other resources describing this domain

PfamGluR_Homer-bdg
InterProIPR019588