The STAT_int domain within your query sequence starts at position 2 and ends at position 126, and its E-value is 2.3e-60.

AMWIQAQQLQGDALHQMQALYGQHFPIEVRHYLSQWIESQAWDSIDLDNPQENIKATQLLEGLVQELQKKAEHQVGEDGFLLKIKLGHYATQLQSTYDRCPMELVRCIRHILYNEQRLVREANNG
STAT_int

STAT_int

STAT protein, protein interaction domain
SMART ACC:SM000964
Description:STAT proteins (Signal Transducers and Activators of Transcription) are a family of transcription factors that are specifically activated to regulate gene transcription when cells encounter cytokines and growth factors. STAT proteins also include an SH2 domain.
InterPro ACC:IPR013799
InterPro abstract:

The STAT protein (Signal Transducers and Activators of Transcription) family contains transcription factors that are specifically activated to regulate gene transcription when cells encounter cytokines and growth factors, hence they act as signal transducers in the cytoplasm and transcription activators in the nucleus [ PUBMED:12039028 expand

GO process:regulation of DNA-templated transcription (GO:0006355), signal transduction (GO:0007165)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 2 132 STAT_int domains in 2 121 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing STAT_int domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing STAT_int domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Transcription

Relevant references for this domain

Primary literature for the STAT_int domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a STAT_int domain which could be assigned to a KEGG orthologous group, and not all proteins containing STAT_int domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamSTAT_int
InterProIPR013799