The PINT domain within your query sequence starts at position 100 and ends at position 189, and its E-value is 6.59e-14.

ANEAQLLRKIQLLCLMEMTFTRPANHRQLTFEEIAKSAKITVNKVELLVMKALSVGLVRGSIDEVDKRVHMTWVQPRVLDLQQVRGLGPC
PINT

PINT

motif in proteasome subunits, Int-6, Nip-1 and TRIP-15
SMART ACC:SM000088
Description:Also called the PCI (Proteasome, COP9, Initiation factor 3) domain. Unknown function.
InterPro ACC:IPR000717
InterPro abstract:

The PCI (for Proteasome, COP9, Initiation factor 3) domain (sometimes also referred to as the PINT domain, for Proteasome subunits, Int-6, Nip-1, and Trip-15) is present in six different subunits of 26 proteasome lid, COP9 signalosome (CSN) and eukaryotic translation initiation factor-3 (eIF3) complexes, as well as in subunits of certain other multiprotein complexes. The PCI domain mediates and … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 19 958 PINT domains in 19 945 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing PINT domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing PINT domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a PINT domain which could be assigned to a KEGG orthologous group, and not all proteins containing PINT domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR000717