The PHB domain within your query sequence starts at position 23 and ends at position 158, and its E-value is 8.76e-15.

ASIHKIEEGHLAVYYRGGALLTSPSGPGYHIMLPFITTFRSVQTTLQTDEVKNVPCGTSGGVMIYIDRIEVVNMLAPYAVFDIVRNYTADYDKTLIFNKIHHELNQFCSAHTLQEVYIELFDQIDENLKQALQKDL
PHB

PHB

prohibitin homologues
SMART ACC:SM000244
Description:prohibitin homologues
InterPro ACC:IPR001107
InterPro abstract:

The band-7 protein family comprises a diverse set of membrane-bound proteins characterised by the presence of a conserved domain, the band-7 domain, also known as SPFH or PHB domain [ PUBMED:10542406 ]. The exact function of the band-7 domain is not known, but examples from animal and bacterial stomatin-type proteins … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 67 158 PHB domains in 67 131 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing PHB domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing PHB domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the PHB domain is listed below. Automatically-derived, secondary literature is also available.

Disease genes where sequence variants are found in this domain

UniRef sequences and OMIM curated human diseases associated with missense mutations within the PHB domain.

ProteinDescriptionDisease / phenotype
PHB_HUMANOMIM:176705 : Breast cancer, sporadic
PODO_HUMANOMIM:600995 : Nephrotic syndrome, idiopathic, steroid-resistant
OMIM:604766 : Nephrotic syndrome, steroid-resistant
OMIM:600995 : no description

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a PHB domain which could be assigned to a KEGG orthologous group, and not all proteins containing PHB domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamBand_7
InterProIPR001107
PROSITEBAND_7