The Galanin domain within your query sequence starts at position 20 and ends at position 124, and its E-value is 3.41e-68.

ATLGLGMPAKEKRGWTLNSAGYLLGPHAIDNHRSFSDKHGLTGKRELQLEVEERRPGSVDVPLPESNIVRTIMEFLSFLHLKEAGALDSLPGIPLATSSEDLEKS
Galanin

Galanin

Galanin
SMART ACC:SM000071
Description:Galanin [1,2,3] is a neuropeptide that controls various biological activities: it regulates the release growth hormone, inhibits the release of insulin and somatostatin, contracts smooth muscle of the gastrointestinal and genitourinary tract and may be involved in the control of adrenal secretion
InterPro ACC:IPR008175
InterPro abstract:

Galanin is a peptide hormone that controls various biological activities [ PUBMED:1710578 ]. Galanin-like immuno-reactivity has been found in the central and peripheral nervous systems of mammals, with high concentrations demonstrated in discrete regions of the central nervous system, including the median eminence, hypothalamus … expand

GO component:extracellular region (GO:0005576)
GO function:hormone activity (GO:0005179)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 387 Galanin domains in 386 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing Galanin domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing Galanin domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the Galanin domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a Galanin domain which could be assigned to a KEGG orthologous group, and not all proteins containing Galanin domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

Links to other resources describing this domain

InterProIPR008175