The NEUZ domain within your query sequence starts at position 43 and ends at position 166, and its E-value is 8.33e-66.

ATPLLFHPHTKGSQILMDLSHKAVKRQASFCNAITFSNRPVLIYEQVRLKITKKQCCWSGALRLGFTSKDPSRIHPDSLPKYACPDLVSQSGFWAKALPEEFANEGNIIAFWVDKKGRVFYRIN
NEUZ

NEUZ

SMART ACC:SM000588
Description:domain in neuralized proteins
InterPro ACC:IPR006573
InterPro abstract:

The neuralized homology repeat (NHR) domain is a module of ~160 amino acids, which has been identified as a tandem repeat in drosophila neuralized, a protein involved in development of the central and peripheral nervous system [ PUBMED:9519875 ]. Several other fly, worm, and mammalian neuralized-like proteins were found … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 5 025 NEUZ domains in 1 679 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing NEUZ domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing NEUZ domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the NEUZ domain is listed below. Automatically-derived, secondary literature is also available.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR006573