The PQQ domain within your query sequence starts at position 775 and ends at position 808, and its E-value is 5.29e-1.

AVQDKPSTTVYIGSHSHTVKAVDLSSGETRWEQL
PQQ

PQQ

beta-propeller repeat
SMART ACC:SM000564
Description:Beta-propeller repeat occurring in enzymes with pyrrolo-quinoline quinone (PQQ) as cofactor, in Ire1p-like Ser/Thr kinases, and in prokaryotic dehydrogenases.
InterPro ACC:IPR018391
InterPro abstract:

Pyrrolo-quinoline quinone (PQQ) is a redox coenzyme, which serves as a cofactor for a number of enzymes (quinoproteins) and particularly for some bacterial dehydrogenases [ PUBMED:2549854 PUBMED:2572081 PUBMED:18838797 expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 237 300 PQQ domains in 48 510 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing PQQ domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing PQQ domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the PQQ domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a PQQ domain which could be assigned to a KEGG orthologous group, and not all proteins containing PQQ domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR018391