The MAM domain within your query sequence starts at position 170 and ends at position 329, and its E-value is 9.26e-42.

CDFEENHLCGFVNRWNPNVNWFVGGGTAKNTHSILPQDHTFRSEHGHYMYVDSVYVKHFQEVAQLISPVTTASMSGCLSFYYQLQQGNDNVFSVYTRDMAGLYEEIWKVDSPGNAAWNLAEVEFSAPYPMEVIFEVAFNGPKGGYVALDDISFSPVHCQN
MAM

MAM

Domain in meprin, A5, receptor protein tyrosine phosphatase mu (and others)
SMART ACC:SM000137
Description:Likely to have an adhesive function. Mutations in the meprin MAM domain affect noncovalent associations within meprin oligomers. In receptor tyrosine phosphatase mu-like molecules the MAM domain is important for homophilic cell-cell interactions.
InterPro ACC:IPR000998
InterPro abstract:

MAM is an acronym derived from meprin, A-5 protein, and receptor protein-tyrosine phosphatase mu. The MAM domain consists of approximately 170 amino acids. It occurs in several cell surface proteins and is likely to have an adhesive function [ PUBMED:8387703 ]. The domain has been shown to play a role in homodimerization … expand

GO component:membrane (GO:0016020)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 13 548 MAM domains in 5 639 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing MAM domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing MAM domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the MAM domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a MAM domain which could be assigned to a KEGG orthologous group, and not all proteins containing MAM domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR000998
PROSITEMAM_DOMAIN
PfamMAM