The Integrin_B_tail domain within your query sequence starts at position 645 and ends at position 721, and its E-value is 4.22e-18.

CEQYRDCAECGAFGTGPLAANCSVVCADVNVTLTLAPNLDDGWCKERTIDNQLFFFLVEHAASGIVLRVRPQEKGVD
Integrin_B_tail

Integrin_B_tail

SMART ACC:SM001242
Description:This is the beta tail domain of the Integrin protein. Integrins are receptors which are involved in cell-cell and cell-extracellular matrix interactions.
InterPro ACC:IPR012896
InterPro abstract:

This entry represents the tail domain of the integrin beta subunit. It forms a four-stranded β-sheet that contains parallel and antiparallel strands and faces an α helix found at the N terminus of this domain [ PUBMED:11546839 ]. Interactions between the α-helix and the β-sheet are mostly hydrophobic and involve a disulphide … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 3 207 Integrin_B_tail domains in 3 193 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing Integrin_B_tail domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing Integrin_B_tail domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a Integrin_B_tail domain which could be assigned to a KEGG orthologous group, and not all proteins containing Integrin_B_tail domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR012896
PfamIntegrin_B_tail