The FN1 domain within your query sequence starts at position 2085 and ends at position 2129, and its E-value is 3.72e-19.

CFDPYTVSHYAIGEEWERLSDAGFKLTCQCLGFGSGHFRCDSSKW
FN1

FN1

Fibronectin type 1 domain
SMART ACC:SM000058
Description:One of three types of internal repeat within the plasma protein, fibronectin. Found also in coagulation factor XII, HGF activator and tissue-type plasminogen activator. In t-PA and fibronectin, this domain type contributes to fibrin-binding.
InterPro ACC:IPR000083
InterPro abstract:

Fibronectin type I repeats are one of the three repeats found in the fibronectin protein. Fibronectin is a plasma protein that binds cell surfaces and various compounds including collagen, fibrin, heparin, DNA, and actin. Type I domain (FN1) is approximately 40 residues in length. Four conserved cysteines are involved in disulphide bonds. The 3D structure of the FN1 domain has been determined … expand

GO component:extracellular region (GO:0005576)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 16 589 FN1 domains in 1 850 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing FN1 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing FN1 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the FN1 domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a FN1 domain which could be assigned to a KEGG orthologous group, and not all proteins containing FN1 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PROSITEFN1_DOMAIN
InterProIPR000083
Pfamfn1