The GDNF domain within your query sequence starts at position 243 and ends at position 337, and its E-value is 1.62e-28.

CLNLQDSCKTNYICRSRLADFFTNCQPESRSVSNCLKENYADCLLAYSGLIGTVMTPNYIDSSSLSVAPWCDCSNSGNDLEDCLKFLNFFKDNTC
GDNF

GDNF

GDNF/GAS1 domain
SMART ACC:SM000907
Description:This cysteine rich domain is found in multiple copies in GNDF and GAS1 proteins. GDNF and neurturin (NTN) receptors are potent survival factors for sympathetic, sensory and central nervous system neurons (PUBMED:16551639), (PUBMED:9192899). GDNF and neurturin promote neuronal survival by signaling through similar multicomponent receptors that consist of a common receptor tyrosine kinase and a member of a GPI-linked family of receptors that determines ligand specificity (PUBMED:9192898).
InterPro ACC:IPR016017
InterPro abstract:

This cysteine rich domain is found in multiple copies in GNDF and GAS1 proteins. GDNF and neurturin (NTN) receptors are potent survival factors for sympathetic, sensory and central nervous system neurons [ PUBMED:16551639 PUBMED:9192899 ]. GDNF … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 7 226 GDNF domains in 2 899 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing GDNF domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing GDNF domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Signalling

Relevant references for this domain

Primary literature for the GDNF domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a GDNF domain which could be assigned to a KEGG orthologous group, and not all proteins containing GDNF domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamGDNF
InterProIPR016017