The PX domain within your query sequence starts at position 13 and ends at position 120, and its E-value is 2.4e-21.

CPSVSIPSSDEHREKKKRFTVYKVLVSVGRSEWFVFRRYAEFDKLYNSLKKQFPAMALKIPAKRIFGDNFDPDFIKQRRAGLNEFIQNLVRYPELYNHPDVRAFLQMD
PX

PX

PhoX homologous domain, present in p47phox and p40phox.
SMART ACC:SM000312
Description:Eukaryotic domain of unknown function present in phox proteins, PLD isoforms, a PI3K isoform.
InterPro ACC:IPR001683
InterPro abstract:

The PX (phox) domain [ PUBMED:8931154 ] occurs in a variety of eukaryotic proteins and have been implicated in highly diverse functions such as cell signalling, vesicular trafficking, protein sorting and lipid modification [ PUBMED:10782093 expand

GO function:phosphatidylinositol binding (GO:0035091)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 32 485 PX domains in 32 392 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing PX domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing PX domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Signalling

Relevant references for this domain

Primary literature for the PX domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a PX domain which could be assigned to a KEGG orthologous group, and not all proteins containing PX domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamPX
InterProIPR001683