The EGF_Lam domain within your query sequence starts at position 719 and ends at position 764, and its E-value is 3.1e-11.

CTCNQHGTCDPNTGICLCGHHTEGPSCERCMPGFYGNAFSGRADDC
EGF_Lam

EGF_Lam

Laminin-type epidermal growth factor-like domai
SMART ACC:SM000180
Description: -
InterPro ACC:IPR002049
InterPro abstract:

This entry represents the laminin-type EGF-like domain (LE) found in Laminin subunit gamma-1 and Netrin-1 from Homo sapiens and Mus musculus.

Laminins are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation [ PUBMED:2404817 expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 106 401 EGF_Lam domains in 19 990 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing EGF_Lam domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing EGF_Lam domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Disease genes where sequence variants are found in this domain

UniRef sequences and OMIM curated human diseases associated with missense mutations within the EGF_Lam domain.

ProteinDescriptionDisease / phenotype
LAMA2_HUMANOMIM:156225 : Muscular dystrophy, congenital merosin-deficient

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a EGF_Lam domain which could be assigned to a KEGG orthologous group, and not all proteins containing EGF_Lam domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamEGF
PROSITELAMININ_TYPE_EGF
InterProIPR002049