The START domain within your query sequence starts at position 10 and ends at position 213, and its E-value is 8.11e-52.

DEQFREACAELQKPALTGADWQLLVEASGITIYRLLDQPSGLYEYKVFGVLEGCSPALLADVYMDLDYRKQWDQYVKELYEKESDEQMVAYWEVKYPFPLSNRDYVYTRQRRDLDVDGRKIYVVLAQSISAPQFPEKSGVIRVKQYKQSLAIESDGKKGSRVFMYYFDNPGGQIPSWLINWAAKNGVPNFLKDMVKACQNYHKK
START

START

in StAR and phosphatidylcholine transfer protein
SMART ACC:SM000234
Description:putative lipid-binding domain in StAR and phosphatidylcholine transfer protein
InterPro ACC:IPR002913
InterPro abstract:

START (StAR-related lipid-transfer) is a lipid-binding domain in StAR, HD-ZIP and signalling proteins [ PUBMED:10322415 ]. StAR (Steroidogenic Acute Regulatory protein) is a mitochondrial protein that is synthesised in response to luteinising hormone stimulation [ PUBMED:7961770 expand

GO function:lipid binding (GO:0008289)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 8 911 START domains in 8 896 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing START domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing START domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a START domain which could be assigned to a KEGG orthologous group, and not all proteins containing START domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR002913