The DHDPS domain within your query sequence starts at position 28 and ends at position 319, and its E-value is 8.34e-81.

DIAGIYPPVTTPFTATAEVDYGKLEENLNRLATFPFRGFVVQGSTGEFPFLTSLERLEVVSRVRQAIPKDKFLIAGSGCESTQATVEMTVSMAQVGADVAMVVTPCYYRGRMSSAALIHHYTKVADVSPIPVVLYSVPANTGLELPVDAVVTLSQHPNIIGLKDSGGDVTRIGLIVHKTSKQDFQVLAGSAGFLLASYAVGAVGGICGLANVLGAQVCQLERLCLTGQWEAAQELQHRLIEPNTAVTRRFGIPGLKKTMDWFGYYGGPCRAPLQELSPTEEEALRLDFSNNG
DHDPS

DHDPS

Dihydrodipicolinate synthetase family
SMART ACC:SM001130
Description:This family has a TIM barrel structure. This enzyme belongs to the family of lyases, specifically the hydro-lyases, which cleave carbon-oxygen bonds.
InterPro ACC:IPR002220
InterPro abstract:

Dihydrodipicolinate synthase ( EC:4.2.1.52 ) (DHDPS, DapA) catalyses, in higher plants, some fungi and bacteria (gene dapA), the first reaction specific to the biosynthesis of lysine and of diaminopimelate [ PUBMED:22949190 ]. DHDPS is responsible for … expand

GO function:lyase activity (GO:0016829)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 57 397 DHDPS domains in 57 392 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing DHDPS domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing DHDPS domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Metabolic

Relevant references for this domain

Primary literature for the DHDPS domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a DHDPS domain which could be assigned to a KEGG orthologous group, and not all proteins containing DHDPS domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR002220
PfamDHDPS