The DUF4217 domain within your query sequence starts at position 550 and ends at position 613, and its E-value is 1.65e-26.

DIQSQLEKLIEKNYFLHKSAQEAYKSYIRAYDSHSLKQIFNVNNLNLPQVALSFGFKVPPFVDL
DUF4217

DUF4217

SMART ACC:SM001178
Description:This short domain is found at the C-terminus of many helicase proteins.
InterPro ACC:IPR025313
InterPro abstract:

This short domain is found towards the C-terminal of many eukaryotic helicases, including some DEAD box helicases such as ATP-dependent rRNA helicase SPB4 from Saccharomyces cerevisiae. The DEAD box helicases are involved in various aspects of RNA metabolism, including nuclear transcription, pre mRNA splicing, ribosome biogenesis, nucleocytoplasmic transport, translation, RNA decay and organellar … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 6 786 DUF4217 domains in 6 779 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing DUF4217 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing DUF4217 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a DUF4217 domain which could be assigned to a KEGG orthologous group, and not all proteins containing DUF4217 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR025313
PfamDUF4217