The LANC_like domain within your query sequence starts at position 96 and ends at position 444, and its E-value is 2.51e-148.

DPHDCSAYTGWTGIALLYLQLYRVTGDQTYLLRSLDYVKRTLRNLSGRRVTFLCGDAGPLAVGAVIYHKLKSECESQECITKLLQMHRTIVCQESELPDELLYGRAGYLYALLYLNTEIGPGTVGETAIKEVVSAIIESGKSLSREERKSERCPLLYQWHRKQYVGAAHGMAGIYYMLMQPEAKVDQETLTEMVKPSIDYVRHKKFRSGNYPSSLSNETDRLVHWCHGAPGVIHVLLQAYQVFKEEKYLKEAMECSDVIWQRGLLRKGYGICHGTSGNGYSFLSLYRLTQDKKYLYRACKFAEWCLDYGAHGCRIPDRPYSLFEGMAGAVHFLSDILVPETARFPAFEL
LANC_like

LANC_like

Lanthionine synthetase C-like protein
SMART ACC:SM001260
Description:Lanthionines are thioether bridges that are putatively generated by dehydration of Ser and Thr residues followed by addition of cysteine residues within the peptide. This family contains the lanthionine synthetase C-like proteins 1 and 2 which are related to the bacterial lanthionine synthetase components C (LanC). LANCL1 (P40 seven-transmembrane-domain protein) and LANCL2 (testes-specific adriamycin sensitivity protein) are thought to be peptide-modifying enzyme components in eukaryotic cells. Both proteins are produced in large quantities in the brain and testes and may have role in the immune surveillance of these organs (PUBMED:11376939). Lanthionines are found in lantibiotics, which are peptide-derived, post-translationally modified antimicrobials produced by several bacterial strains (PUBMED:12127987). This region contains seven internal repeats.
InterPro ACC:IPR007822
InterPro abstract:

The C-terminal of the lantibiotic biosynthesis protein LanM is homologous to LanC [ PUBMED:19393544 PUBMED:23071302 ]. LanC-like protein 1 (included in this family) has been shown to function as a glutathione transferase, and as such has been … expand

GO process:peptide modification (GO:0031179)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 8 676 LANC_like domains in 8 665 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing LANC_like domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing LANC_like domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the LANC_like domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a LANC_like domain which could be assigned to a KEGG orthologous group, and not all proteins containing LANC_like domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamLANC_like
InterProIPR007822