The CaMBD domain within your query sequence starts at position 672 and ends at position 748, and its E-value is 6.51e-51.

DTQLTKRVKNAAANVLRETWLIYKNTKLVKKIDHAKVRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVDLAKTQNI
CaMBD

CaMBD

Calmodulin binding domain
SMART ACC:SM001053
Description:Small-conductance Ca2+-activated K+ channels (SK channels) are independent of voltage and gated solely by intracellular Ca2+. These membrane channels are heteromeric complexes that comprise pore-forming alpha-subunits and the Ca2+-binding protein calmodulin (CaM) (PUBMED:11323678). CaM binds to the SK channel through this the CaM-binding domain (CaMBD), which is located in an intracellular region of the alpha-subunit immediately carboxy-terminal to the pore. Channel opening is triggered when Ca2+ binds the EF hands in the N-lobe of CaM. The structure of this domain complexed with CaM is known (PUBMED:11323678). This domain forms an elongated dimer with a CaM molecule bound at each end; each CaM wraps around three alpha-helices, two from one CaMBD subunit and one from the other.
InterPro ACC:IPR004178
InterPro abstract:

Small-conductance Ca2+-activated K+ channels (SK channels) are independent of voltage and gated solely by intracellular Ca2+. These membrane channels are heteromeric complexes that comprise pore-forming alpha-subunits and the Ca2+-binding protein calmodulin (CaM) [ PUBMED:11323678 ]. CaM binds to the SK channel through … expand

GO process:potassium ion transport (GO:0006813)
GO component:membrane (GO:0016020)
GO function:calcium-activated potassium channel activity (GO:0015269), calmodulin binding (GO:0005516)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 1 789 CaMBD domains in 1 786 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing CaMBD domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing CaMBD domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the CaMBD domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a CaMBD domain which could be assigned to a KEGG orthologous group, and not all proteins containing CaMBD domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR004178
PfamCaMBD