The TAP_C domain within your query sequence starts at position 629 and ends at position 691, and its E-value is 3.7e-24.

DTSFKPLLSEEQQEMVKSFSVQSGMKLDWSQKCLQDNEWDYTKAGEAFTALQNEGKIPKEFFK
TAP_C

TAP_C

C-terminal domain of vertebrate Tap protein
SMART ACC:SM000804
Description:The vertebrate Tap protein is a member of the NXF family of shuttling transport receptors for the nuclear export of mRNA. Its most C-terminal domain is important for binding to FG repeat-containing nuclear pore proteins (FG-nucleoporins) and is sufficient to mediate shuttling. This domain forms a compact four-helix fold related to that of a UBA domain.
InterPro ACC:IPR005637
InterPro abstract:

The vertebrate Tap protein is a member of the NXF family of shuttling transport receptors for nuclear export of mRNA. Tap has a modular structure, and its most C-terminal domain is important for binding to FG repeat-containing nuclear pore proteins (FG-nucleoporins) and is sufficient to mediate nuclear shuttling [ PUBMED:11875519 expand

GO process:mRNA transport (GO:0051028)
GO component:nucleus (GO:0005634)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 1 825 TAP_C domains in 1 815 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing TAP_C domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing TAP_C domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:

Relevant references for this domain

Primary literature for the TAP_C domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a TAP_C domain which could be assigned to a KEGG orthologous group, and not all proteins containing TAP_C domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamTAP_C
InterProIPR005637