The PUG domain within your query sequence starts at position 30 and ends at position 91, and its E-value is 1.83e-22.

EASKLLLTYADNILRNPSDEKYRSIRIGNTAFSTRLLPVRGAVECLFEMGFEEGETHLIFPK
PUG

PUG

domain in protein kinases, N-glycanases and other nuclear proteins
SMART ACC:SM000580
Description: -
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 3 290 PUG domains in 3 261 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing PUG domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing PUG domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the PUG domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a PUG domain which could be assigned to a KEGG orthologous group, and not all proteins containing PUG domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain