The JmjN domain within your query sequence starts at position 13 and ends at position 54, and its E-value is 3.45e-23.

ECPVFEPSWAEFRDPLGYIAKIRPIAEKSGICKIRPPADWQP
JmjN

JmjN

Small domain found in the jumonji family of transcription factors
SMART ACC:SM000545
Description:To date, this domain always co-occurs with the JmjC domain (although the reverse is not true).
InterPro ACC:IPR003349
InterPro abstract:

This entry represents the JmjN domain.

The JmjN and JmjC domains are two non-adjacent domains which have been identified in the jumonji family of transcription factors. Although it wasoriginally suggested that the JmjN and JmjC domains always co-occur and might form a single functional unit within the folded protein, the JmjC domain was later found without the JmjN domain in organisms … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 6 190 JmjN domains in 6 180 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing JmjN domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing JmjN domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the JmjN domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a JmjN domain which could be assigned to a KEGG orthologous group, and not all proteins containing JmjN domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR003349