The Tankyrase_bdg_C domain within your query sequence starts at position 130 and ends at position 299, and its E-value is 5.69e-103.

EDDFSFIHQTSVLDSSALKTRVQLSKRSRRRAPISHSLRRSQFSESESRSPLEEESHSTWMFKDSTEEKSPRRDESDEEPPRVERTPVSHPQRMPVFPGMDPAVLKAQLPKRSEVDSPGDSLSWTPQPKSPKSPFHPGVLGSRVLPPSTEKEERSEECSPQWLKELKSKK
Tankyrase_bdg_C

Tankyrase_bdg_C

Tankyrase binding protein C terminal domain
SMART ACC:SM001319
Description:This protein domain family is found at the C-terminal end of the Tankyrase binding protein in eukaryotes. The precise function of this protein is still unknown. However, it is known interacts with the enzyme tankyrase, a telomeric poly(ADP-ribose) polymerase, by binding to it. Tankyrin catalyses poly(ADP-ribose) chain formation onto proteins. More specifically, it binds to the ankyrin domain in tankyrase (PMID:11854288). The protein domain is approximately 170 amino acids in length and contains two conserved sequence motifs: FPG and LKA.
InterPro ACC:IPR032764
InterPro abstract:

This protein domain is found at the C-terminal end of the Tankyrase binding protein in eukaryotes. The precise function of this protein is still unknown. However, it is known that interacts with the enzyme tankyrase, a telomeric poly(ADP-ribose) polymerase, by binding to it. Tankyrin catalyses poly(ADP-ribose) chain formation onto proteins. More specifically, it binds to the ankyrin domain in … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 703 Tankyrase_bdg_C domains in 703 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing Tankyrase_bdg_C domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing Tankyrase_bdg_C domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the Tankyrase_bdg_C domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a Tankyrase_bdg_C domain which could be assigned to a KEGG orthologous group, and not all proteins containing Tankyrase_bdg_C domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

Links to other resources describing this domain

InterProIPR032764
PfamTankyrase_bdg_C