The DUF3635 domain within your query sequence starts at position 664 and ends at position 753, and its E-value is 3.83e-45.

EDLFTGEGDYQFEIYRLMRKENKNCWGEYHPYNNVLWLHYLTDKILNKMKFKTKCQSAAMKQIRKNLQHFHRTVLSFSSATDLLCQHSLF
DUF3635

DUF3635

Domain of unknown function
SMART ACC:SM001331
Description:This family may be a potential Haspin-related leucine-zipper. A leucine zipper was proposed to be present towards the C-terminus of human Haspin, (up-stream of the current family) (PMID:10358056); however, as this domain would appear to span several helices and be largely within a loop structure (PMID:12737306) the actual zipper might be further downstream, and be this family, which is the very C-terminal part of the Sch. pombe sequence.
InterPro ACC:IPR024604
InterPro abstract:

This domain may be a potential Haspin-related leucine-zipper. A leucine zipper was proposed to be present towards the C-terminal of human Haspin, (upstream of the current family) [ PUBMED:10358056 ]; however, as this domain would appear to span several helices and be largely within a loop structure [ expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 1 291 DUF3635 domains in 1 290 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing DUF3635 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing DUF3635 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the DUF3635 domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a DUF3635 domain which could be assigned to a KEGG orthologous group, and not all proteins containing DUF3635 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamDUF3635
InterProIPR024604