The DUF4187 domain within your query sequence starts at position 195 and ends at position 263, and its E-value is 1.51e-25.

EEETEEEEEEKEEQDEDECPSEDLSVLEKLQILTGYLREEHLYCIWCGTAYEDKEDLSSNCPGPTSADH
DUF4187

DUF4187

SMART ACC:SM001173
Description:This family is found at the very C-terminus of proteins that carry a G-patch domain SM00443. The domain is short and cysteine-rich .
InterPro ACC:IPR025239
InterPro abstract:

This short, cysteine-rich domain is often found C-terminal to a G-patch domain.

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 1 672 DUF4187 domains in 1 670 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing DUF4187 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing DUF4187 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a DUF4187 domain which could be assigned to a KEGG orthologous group, and not all proteins containing DUF4187 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

Links to other resources describing this domain

InterProIPR025239
PfamDUF4187