The H2TH domain within your query sequence starts at position 101 and ends at position 184, and its E-value is 6.13e-6.

EELDICSPKFSFSRAESEVKKQGDRMLCDVLLDQRVLPGVGNIIKNEALFDSGLHPAVKVCQLSDKQACHLVKMTRDFSILFYR
H2TH

H2TH

Formamidopyrimidine-DNA glycosylase H2TH domain
SMART ACC:SM001232
Description:Formamidopyrimidine-DNA glycosylase (Fpg) is a DNA repair enzyme that excises oxidised purines from damaged DNA. This family is the central domain containing the DNA-binding helix-two turn-helix domain (PMID:11912217).
InterPro ACC:IPR015886
InterPro abstract:

This entry represents a helix-2-turn-helix DNA-binding domain found in DNA glycosylase/AP lyase enzymes, which are involved in base excision repair of DNA damaged by oxidation or by mutagenic agents.

Formamidopyrimidine-DNA glycosylases (Fpg, MutM) are trifunctional DNA base excision repair enzymes that remove a wide range of oxidation-damaged bases (N-glycosylase activity; expand

GO process:base-excision repair (GO:0006284)
GO function:damaged DNA binding (GO:0003684), zinc ion binding (GO:0008270), DNA-(apurinic or apyrimidinic site) endonuclease activity (GO:0003906), hydrolase activity, hydrolyzing N-glycosyl compounds (GO:0016799)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 29 516 H2TH domains in 29 516 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing H2TH domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing H2TH domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Transport

Relevant references for this domain

Primary literature for the H2TH domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a H2TH domain which could be assigned to a KEGG orthologous group, and not all proteins containing H2TH domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR015886
PfamH2TH