The Ubox domain within your query sequence starts at position 953 and ends at position 1016, and its E-value is 1.9e-27.

EFLDPIMSTLMSDPVVLPSSRVTVDRSTIARHLLSDQTDPFNRSPLTMDQIRPNTELKEKIQRW
Ubox

Ubox

Modified RING finger domain
SMART ACC:SM000504
Description:Modified RING finger domain, without the full complement of Zn2+-binding ligands. Probable involvement in E2-dependent ubiquitination.
InterPro ACC:IPR003613
InterPro abstract:

This entry represents the U-box domain.

The molecular mechanism underlying the transfer of ubiquitin (Ub) to a substrate consists of three key enzymatic steps. First, ubiquitin itself is adenylated at its C-terminal glycine residue by an activating enzyme (E1). Second, the adenylated Ub forms a covalent linkage to a conjugating enzyme (E2). Finally, a ligating enzyme (E3) recruits both … expand

GO process:protein ubiquitination (GO:0016567)
GO function:ubiquitin-protein transferase activity (GO:0004842)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 15 830 Ubox domains in 15 767 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing Ubox domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing Ubox domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the Ubox domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a Ubox domain which could be assigned to a KEGG orthologous group, and not all proteins containing Ubox domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR003613