The Costars domain within your query sequence starts at position 298 and ends at position 374, and its E-value is 6.22e-45.

EHIYREIMELCFVIRTMARHRRDGKIQVTFGELFDRYVRISDKVVGILMRARKHGLVHFEGEMLWQGRDDHVVITLL
Costars

Costars

SMART ACC:SM001283
Description:This domain is found both alone and at the C-terminus of actin-binding Rho-activating protein (ABRA). It binds to actin, and in muscle regulates the actin cytoskeleton and cell motility PMID:11983702, 20940261. It has a winged helix-like fold consisting of three alpha-helices and four antiparallel beta strands. Unlike typical winged helix proteins it does not bind to DNA, but contains a hydrophobic groove which may be responsible for interaction with other proteins PMID:21082705 .
InterPro ACC:IPR027817
InterPro abstract:

This domain is found both alone (in the costars family of proteins) and at the C terminus of actin-binding Rho-activating protein (ABRA). It binds to actin, and in muscle regulates the actin cytoskeleton and cell motility [ PUBMED:11983702 PUBMED:20940261 expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 1 244 Costars domains in 1 240 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing Costars domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing Costars domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the Costars domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a Costars domain which could be assigned to a KEGG orthologous group, and not all proteins containing Costars domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamCostars
InterProIPR027817