The RPR domain within your query sequence starts at position 537 and ends at position 676, and its E-value is 1.42e-41.

EQRDKLEEILRGLTPRKNDIGDAMVFCLNNAEAAEEIVDCITESLSILKTPLPKKIARLYLVSDVLYNSSAKVANASYYRKFFETKLCQIFSDLNATYRTIQGHLQSENFKQRVMTCFRAWEDWAIYPEPFLIKLQNIFL
RPR

RPR

SMART ACC:SM000582
Description:domain present in proteins, which are involved in regulation of nuclear pre-mRNA
InterPro ACC:IPR006569
InterPro abstract:

The C-terminal domain (CTD) of the large subunit of RNA polymerase II is a platform for mRNA processing factors and links gene transcription to mRNA capping, splicing and polyadenylation. CTD recognition is dependent on the phosphorylation state of the CTD itself, which varies during the course of transcription but has also been linked to the isomerization state of the CTD's proline residues. … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 9 580 RPR domains in 9 578 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing RPR domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing RPR domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the RPR domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a RPR domain which could be assigned to a KEGG orthologous group, and not all proteins containing RPR domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR006569