The AARP2CN domain within your query sequence starts at position 228 and ends at position 309, and its E-value is 1.14e-28.

ESGMLLRQLANQKQRHLAFRDRRAYLFAHVADFVPSEESDLVGTLKISGYVRGRTLNVNSLLHIVGHGDFQMNQIDAPVDPF
AARP2CN

AARP2CN

AARP2CN (NUC121) domain
SMART ACC:SM000785
Description:This domain is the central domain of AARP2. It is weakly similar to the GTP-binding domain of elongation factor TU (PUBMED:15112237).
InterPro ACC:IPR012948
InterPro abstract:

This domain is the central domain of AARP2 (asparagine and aspartate rich protein 2). It is weakly similar to the GTP-binding domain of elongation factor TU [ PUBMED:15112237 ]. PfAARP2 is an antigen from Plasmodium falciparum of 150kDa, which is encoded by a unique gene on chromosome 1 [ PUBMED:9247928 expand

GO process:ribosome biogenesis (GO:0042254)
GO component:nucleus (GO:0005634)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 3 353 AARP2CN domains in 3 350 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing AARP2CN domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing AARP2CN domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Translation
Binding / catalysis:GTP-binding ?

Relevant references for this domain

Primary literature for the AARP2CN domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a AARP2CN domain which could be assigned to a KEGG orthologous group, and not all proteins containing AARP2CN domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR012948
PfamAARP2CN