The PCRF domain within your query sequence starts at position 75 and ends at position 189, and its E-value is 2.26e-36.

ESLLHDENEDLKKLAESEIALCQKQITELKHQIISLLVPSEEMDGSDLILEVTAGVGGQEAMLFTSEMFDMYQQYAAFKRWHFETLEYFPSELGGLRHASASVGGPEAYRHMKFE
PCRF

PCRF

SMART ACC:SM000937
Description:This domain is found in peptide chain release factors.
InterPro ACC:IPR005139
InterPro abstract:

This domain is found in bacterial, mitochondrial and chloroplastic peptide chain release factors. In bacteria, termination of protein synthesis depends on the type I release factors, RF1 and RF2 [ PUBMED:2215213 ]. Both contain this domain.

GO process:translational termination (GO:0006415)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 39 330 PCRF domains in 39 328 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing PCRF domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing PCRF domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Metabolic

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a PCRF domain which could be assigned to a KEGG orthologous group, and not all proteins containing PCRF domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamPCRF
InterProIPR005139