The NGF domain within your query sequence starts at position 128 and ends at position 232, and its E-value is 1.41e-78.

FHMGEFSVCDSVSVWVGDKTTATDIKGKEVTVLAEVNINNSVFRQYFFETKCRASNPVESGCRGIDSKHWNSYCTTTHTFVKALTTDEKQAAWRFIRIDTACVCV
NGF

NGF

Nerve growth factor (NGF or beta-NGF)
SMART ACC:SM000140
Description:NGF is important for the development and maintenance of the sympathetic and sensory nervous systems.
InterPro ACC:IPR002072
InterPro abstract:

During the development of the vertebrate nervous system, many neurons become redundant (because they have died, failed to connect to target cells, etc.) and are eliminated. At the same time, developing neurons send out axon outgrowths that contact their target cells [ PUBMED:2369898 ]. Such cells control their degree … expand

GO function:signaling receptor binding (GO:0005102)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 4 294 NGF domains in 4 293 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing NGF domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing NGF domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the NGF domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a NGF domain which could be assigned to a KEGG orthologous group, and not all proteins containing NGF domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

3D structures in PDB containing this domain

Links to other resources describing this domain

PROSITENGF_DOMAIN
InterProIPR002072
PfamNGF