The GPS domain within your query sequence starts at position 771 and ends at position 823, and its E-value is 2.1e-27.

FNANCSFWNYSERTMMGYWSTQGCKLVDTNKTRTTCACSHLTNFAILMAHREI
GPS

GPS

G-protein-coupled receptor proteolytic site domain
SMART ACC:SM000303
Description:Present in latrophilin/CL-1, sea urchin REJ and polycystin.
InterPro ACC:IPR000203
InterPro abstract:

The GPS motif is an integral part, and the most conserved region, of a much larger (320-residue approximately) domain that has been termed GPCR-Autoproteolysis INducing (GAIN) domain. The GAIN domain represents an autoproteolytic fold whose function is relevant for GPCR signalling and may regulate this process [ PUBMED:22333914 expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 16 036 GPS domains in 15 953 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing GPS domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing GPS domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the GPS domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a GPS domain which could be assigned to a KEGG orthologous group, and not all proteins containing GPS domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR000203