The LRR domain within your query sequence starts at position 931 and ends at position 961, and its E-value is 8.53e0.

FSSLQHLDLDSLSENKIGDKGVSKLSATFPQ
LRR

LRR

Leucine-rich repeats, outliers
SMART ACC:SM000370
Description: -
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 1 323 917 LRR domains in 210 080 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing LRR domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing LRR domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Signalling
Translation
Binding / catalysis:Protein-binding

Relevant references for this domain

Primary literature for the LRR domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a LRR domain which could be assigned to a KEGG orthologous group, and not all proteins containing LRR domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain