The Glyco_18 domain within your query sequence starts at position 79 and ends at position 385, and its E-value is 3.54e-27.

GEVLGYVTPWNSHGYDVAKVFGSKFTQISPVWLQLKRRGREMFEITGLHDVDQGWMRAVKKHAKGVRIVPRLLFEDWTYDDFRNVLDSEDEIEELSKTVAQVAKNQHFDGFVVEVWSQLLSQKHVGLIHMLTHLAEALHQARLLVILVIPPAVTPGTDQLGMFTHKEFEQLAPILDGFSLMTYDYSTSQQPGPNAPLSWIRACVQVLDPKSQWRSKILLGLNFYGMDYAASKDAREPVIGARYVQTLKDHRPRVVWDSQAAEHFFEYKKNRGGRHVVFYPTLKSLQVRLELARELGVGVSIWELGQG
Glyco_18

Glyco_18

SMART ACC:SM000636
Description: -
InterPro ACC:IPR011583
InterPro abstract:

This entry represents the catalytic domain of a group of proteins from the glycoside hydrolase, family 18 . Members of this family belong to the chitinase class II/V and IDGF (Imaginal disk growth factor) groups, which includes chitinase, chitodextrinase and the killer toxin of Kluyveromyces lactis (Yeast) (Candida sphaerica). The chitinases hydrolyse chitin oligosaccharides. However, glycoside … expand

GO function:chitin binding (GO:0008061)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 27 162 Glyco_18 domains in 25 962 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing Glyco_18 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing Glyco_18 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a Glyco_18 domain which could be assigned to a KEGG orthologous group, and not all proteins containing Glyco_18 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR011583
PfamGlyco_hydro_18