The HintN domain within your query sequence starts at position 197 and ends at position 304, and its E-value is 1.29e-25.

GGCFPGNATVRLRSGERKGLRELHRGDWVLAADAAGRVVPTPVLLFLDRDLQRRASFVAVETERPPRKLLLTPWHLVFAARGPAPAPGDFAPVFARRLRAGDSVLAPG
HintN

HintN

Hint (Hedgehog/Intein) domain N-terminal region
SMART ACC:SM000306
Description:Hedgehog/Intein domain, N-terminal region. Domain has been split to accommodate large insertions of endonucleases.
InterPro ACC:IPR003587
InterPro abstract:

This entry represents the N-terminal region of the hint domain.

Hedgehog proteins are a family of secreted signal molecules required for embryonic cell differentiation. They are synthesised as inactive precursors with an N-terminal signalling domain linked to a C-terminal autoprocessing domain. The three-dimensional structure of the autolytic domain of the hedgehog protein of shows similarity … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 10 871 HintN domains in 9 985 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing HintN domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing HintN domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Disease genes where sequence variants are found in this domain

UniRef sequences and OMIM curated human diseases associated with missense mutations within the HintN domain.

ProteinDescriptionDisease / phenotype
SHH_HUMANOMIM:600725 : Holoprosencephaly-3
OMIM:142945 : no description

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a HintN domain which could be assigned to a KEGG orthologous group, and not all proteins containing HintN domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamHint
InterProIPR003587