The Drf_FH3 domain within your query sequence starts at position 230 and ends at position 421, and its E-value is 6.1e-71.

GGHEIILAAFDNFKEVCKELHRFEKLMEYFRNEDSNIDFMVACMQFINIVVHSVEDMNFRVHLQYEFTKLGLEEFLQKSRHTESEKLQVQIQAYLDNVFDVGGLLEDAETKNVALEKVEELEEHVSHLTEKLLDLENENMMRVAELEKQLLQREKELESIKETYENTSNQVHTLRRLIKEKEEAFQRRCHLE
Drf_FH3

Drf_FH3

Diaphanous FH3 Domain
SMART ACC:SM001139
Description:This region is found in the Formin-like and and diaphanous proteins [(PUBMED:12676083),(PUBMED:9606213)]
InterPro ACC:IPR010472
InterPro abstract:

Formin homology (FH) proteins play a crucial role in the reorganisation of the actin cytoskeleton, which mediates various functions of the cell cortex including motility, adhesion, and cytokinesis [ PUBMED:10631086 ]. Formins are multidomain proteins that interact with diverse signalling molecules and cytoskeletal proteins … expand

GO process:cellular component organization (GO:0016043)
GO function:actin binding (GO:0003779)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 6 079 Drf_FH3 domains in 6 072 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing Drf_FH3 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing Drf_FH3 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the Drf_FH3 domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a Drf_FH3 domain which could be assigned to a KEGG orthologous group, and not all proteins containing Drf_FH3 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamDrf_FH3
InterProIPR010472