The 6PGD domain within your query sequence starts at position 180 and ends at position 470, and its E-value is 7.75e-219.

GHFVKMVHNGIEYGDMQLICEAYHLMKDVLGMRHEEMAQAFEEWNKTELDSFLIEITANILKYRDTDGKELLPKIRDSAGQKGTGKWTAISALEYGMPVTLIGEAVFARCLSSLKEERVQASQKLKGPKVVQLEGSKKSFLEDIRKALYASKIISYAQGFMLLRQAATEFGWTLNYGGIALMWRGGCIIRSVFLGKIKDAFERNPELQNLLLDDFFKSAVDNCQDSWRRVISTGVQAGIPMPCFTTALSFYDGYRHEMLPANLIQAQRDYFGAHTYELLTKPGEFIHTNWT
6PGD

6PGD

6-phosphogluconate dehydrogenase, C-terminal domain
SMART ACC:SM001350
Description:This family represents the C-terminal all-alpha domain of 6-phosphogluconate dehydrogenase. The domain contains two structural repeats of 5 helices each.
InterPro ACC:IPR006114
InterPro abstract:

6-Phosphogluconate dehydrogenase ( EC:1.1.1.44 ) (6PGD) is an oxidative carboxylase that catalyses the decarboxylating reduction of 6-phosphogluconate into ribulose 5-phosphate in the presence of NADP. This reaction is a component of the hexose mono-phosphate shunt and pentose phosphate pathways (PPP) [ PUBMED:2113917 expand

GO process:pentose-phosphate shunt (GO:0006098)
GO function:phosphogluconate dehydrogenase (decarboxylating) activity (GO:0004616)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 19 935 6PGD domains in 19 931 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing 6PGD domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing 6PGD domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a 6PGD domain which could be assigned to a KEGG orthologous group, and not all proteins containing 6PGD domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

Pfam6PGD
InterProIPR006114