The HABP4_PAI-RBP1 domain within your query sequence starts at position 189 and ends at position 292, and its E-value is 7.04e-47.

GKREFDRHSGSDRSGLKHEDKRGGSGSHNWGTVKDELTDLDQSNVTEETPEGEEHPVADTENKENEVEEVKEEGPKEMTLDEWKAIQNKDRAKVEFNIRKPNEG
HABP4_PAI-RBP1

HABP4_PAI-RBP1

Hyaluronan / mRNA binding family
SMART ACC:SM001233
Description:This family includes the HABP4 family of hyaluronan-binding proteins, and the PAI-1 mRNA-binding protein, PAI-RBP1. HABP4 has been observed to bind hyaluronan (a glucosaminoglycan), but it is not known whether this is its primary role in vivo. It has also been observed to bind RNA, but with a lower affinity than that for hyaluronan (PMID:10887182). PAI-1 mRNA-binding protein specifically binds the mRNA of type-1 plasminogen activator inhibitor (PAI-1), and is thought to be involved in regulation of mRNA stability (PMID:11001948). However, in both cases, the sequence motifs predicted to be important for ligand binding are not conserved throughout the family, so it is not known whether members of this family share a common function.
InterPro ACC:IPR006861
InterPro abstract:

This entry represents a domain found in the HABP4 protein family of hyaluronan-binding proteins, and the PAI-1 mRNA-binding protein, PAI-RBP1. HABP4 has been observed to bind hyaluronan (a glucosaminoglycan), but it is not known whether this is its primary role in vivo. It has also been observed to bind RNA, but with a lower affinity than that for hyaluronan [ PUBMED:10887182 expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 2 755 HABP4_PAI-RBP1 domains in 2 747 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing HABP4_PAI-RBP1 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing HABP4_PAI-RBP1 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Interaction (with the environment)

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a HABP4_PAI-RBP1 domain which could be assigned to a KEGG orthologous group, and not all proteins containing HABP4_PAI-RBP1 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamHABP4_PAI-RBP1
InterProIPR006861