The ORANGE domain within your query sequence starts at position 108 and ends at position 152, and its E-value is 1.71e-18.

GKYRAGFSECMNEVTRFLSTCEGVNTEVRTRLLGHLANCMTQINA
ORANGE

ORANGE

Orange domain
SMART ACC:SM000511
Description:This domain confers specificity among members of the Hairy/E(SPL) family.
InterPro ACC:IPR003650
InterPro abstract:

The Orange domain is a motif of ~35 amino acids present in eukaryotic DNA-binding transcription repressors, which regulate cell differentiation, embryonic patterning and other biological processes in both vertebrates and invertebrates. The Orange domain is located just C-terminal to a basic helix-loop-helix (bHLH) domain in the bHLH-Orange (bHLH-O) proteins. This family of bHLH repressors is … expand

GO process:regulation of DNA-templated transcription (GO:0006355)
GO function:DNA binding (GO:0003677)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 2 966 ORANGE domains in 2 947 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing ORANGE domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing ORANGE domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the ORANGE domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a ORANGE domain which could be assigned to a KEGG orthologous group, and not all proteins containing ORANGE domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR003650