The H15 domain within your query sequence starts at position 94 and ends at position 159, and its E-value is 3.4e-1.

GSKGPPCNDLRNVDWNKLLKRAIEGLEEPNGSSLKNIEKYLRSQPYAQQPMQTPPHANMMYTAPGH
H15

H15

Domain in histone families 1 and 5
SMART ACC:SM000526
Description: -
InterPro ACC:IPR005818
InterPro abstract:

Histone proteins have central roles in both chromatin organisation (as structural units of the nucleosome) and gene regulation (as dynamic components that have a direct impact on DNA transcription and replication). Eukaryotic DNA wraps around a histone octamer to form a nucleosome, the first order of compaction of eukaryotic chromatin. The core histone octamer is composed of a central H3-H4 tetramer … expand

GO process:nucleosome assembly (GO:0006334)
GO component:nucleosome (GO:0000786)
GO function:DNA binding (GO:0003677)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 9 774 H15 domains in 8 995 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing H15 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing H15 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the H15 domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a H15 domain which could be assigned to a KEGG orthologous group, and not all proteins containing H15 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR005818
Pfamlinker_histone