The A4_EXTRA domain within your query sequence starts at position 42 and ends at position 204, and its E-value is 7.91e-123.

GTGFAVAEPQIAMFCGKLNMHVNIQTGKWEPDPTGTKSCLGTKEEVLQYCQEIYPELQITNVMEANQPVNIDSWCRRDKRQCKSHIVIPFKCLVGEFVSDVLLVPDNCQFFHQERMEVCEKHQRWHTLVKEACLTEGLTLYSYGMLLPCGVDQFHGTEYVCCP
A4_EXTRA

A4_EXTRA

amyloid A4
SMART ACC:SM000006
Description:amyloid A4 precursor of Alzheimers disease
InterPro ACC:IPR008154
InterPro abstract:

Amyloid-beta precursor protein (APP, or A4) is associated with Alzheimer's disease (AD), because one of its breakdown products, amyloid-beta (A-beta), aggregates to form amyloid or senile plaques [ PUBMED:16301322 PUBMED:16364896 expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 1 103 A4_EXTRA domains in 1 103 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing A4_EXTRA domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing A4_EXTRA domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the A4_EXTRA domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a A4_EXTRA domain which could be assigned to a KEGG orthologous group, and not all proteins containing A4_EXTRA domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR008154
PROSITEA4_EXTRA