The RIIa domain within your query sequence starts at position 25 and ends at position 62, and its E-value is 7.54e-15.

HNIQALLKDSIVQLCTTRPERPMAFLREYFERLEKEEA
RIIa

RIIa

RIIalpha, Regulatory subunit portion of type II PKA R-subunit
SMART ACC:SM000394
Description:RIIalpha, Regulatory subunit portion of type II PKA R-subunit. Contains dimerisation interface and binding site for A-kinase-anchoring proteins (AKAPs).
InterPro ACC:IPR003117
InterPro abstract:

Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases. Protein kinases catalyse the transfer of the gamma phosphate from nucleotide triphosphates (often ATP) to one or more amino acid residues in a protein substrate side chain, resulting in a conformational change affecting protein function. … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 1 650 RIIa domains in 1 614 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing RIIa domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing RIIa domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Signalling

Relevant references for this domain

Primary literature for the RIIa domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a RIIa domain which could be assigned to a KEGG orthologous group, and not all proteins containing RIIa domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR003117