The C1 domain within your query sequence starts at position 229 and ends at position 278, and its E-value is 4.09e-7.

HQFFVKSFTAPTKCHQCTSLMVGLIRQGCSCEVCGFSCHITCVNKAPTVC
C1

C1

Protein kinase C conserved region 1 (C1) domains (Cysteine-rich domains)
SMART ACC:SM000109
Description:Some bind phorbol esters and diacylglycerol. Some bind RasGTP. Zinc-binding domains.
InterPro ACC:IPR002219
InterPro abstract:

This entry represents the N-terminal region of PKC, known as C1. It has been shown to bind PE and DAG in a phospholipid and zinc-dependent fashion [ PUBMED:2500657 ]. The C1 region contains one or two copies (depending on the isozyme of PKC) of a cysteine-rich domain, which is about 50 amino-acid residues long, and which … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 58 922 C1 domains in 42 393 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing C1 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing C1 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Binding / catalysis:Diacylglycerol-binding, phorbol-ester binding, zinc-binding, RasGTP-binding

Relevant references for this domain

Primary literature for the C1 domain is listed below. Automatically-derived, secondary literature is also available.

Disease genes where sequence variants are found in this domain

UniRef sequences and OMIM curated human diseases associated with missense mutations within the C1 domain.

ProteinDescriptionDisease / phenotype
KPCG_HUMANOMIM:176980 : PROTEIN KINASE C, GAMMA; PRKCG

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a C1 domain which could be assigned to a KEGG orthologous group, and not all proteins containing C1 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR002219
PfamDAG_PE-bind