The RAP domain within your query sequence starts at position 763 and ends at position 822, and its E-value is 4.38e-25.

IELLDVRAFCSNIPHLKGKSAMKKRHLEILGYRVIQIPYFEWNSMAMSTKDARMDYLREH
RAP

RAP

SMART ACC:SM000952
Description:This domain is found in various eukaryotic species, particularly in apicomplexans such as Plasmodium falciparum, where it is found in proteins that are important in various parasite-host cell interactions. It is thought to be an RNA-binding domain (PUBMED:15501674).
InterPro ACC:IPR013584
InterPro abstract:

The ~60-residue RAP (an acronym for RNA-binding domain abundant in Apicomplexans) domain is found in various proteins in eukaryotes. It is particularly abundant in apicomplexans and might mediate a range of cellular functions through its potential interactions with RNA [ PUBMED:15501674 ].

The RAP domain consists … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 3 109 RAP domains in 3 095 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing RAP domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing RAP domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Interaction (with the environment)

Relevant references for this domain

Primary literature for the RAP domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a RAP domain which could be assigned to a KEGG orthologous group, and not all proteins containing RAP domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR013584
PfamRAP