The RICTOR_V domain within your query sequence starts at position 920 and ends at position 992, and its E-value is 1.44e-40.

IKKLKASLWALGNIGSSNWGLNLLQEENVIPDILKLAKQCEVLSIRGTCVYVLGLIAKTKQGCDILKCHSWDS
RICTOR_V

RICTOR_V

Rapamycin-insensitive companion of mTOR, domain 5
SMART ACC:SM001310
Description:Rictor appears to serve as a scaffolding protein that is important for maintaining mTORC2 integrity. The mammalian target of rapamycin (mTOR) is a conserved Ser/Thr kinase that forms two functionally distinct complexes, mTROC1 and mTORC2, important for nutrient and growth-factor signalling. These long eukaryotic proteins carry several well-conserved domains, and this is No.5.
InterPro ACC:IPR029452
InterPro abstract:

This entry represent the conserved domain 5 of the Rictor (Rapamycin-insensitive companion of mTOR) protein.

The mammalian target of rapamycin (mTOR) is a conserved Ser/Thr kinase that forms two functionally distinct complexes, mTROC1 and mTORC2, important for nutrient and growth-factor signalling. Rictor (rapamycin-insensitive companion of mTOR) is a component of mTORC2 [ expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 1 479 RICTOR_V domains in 1 476 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing RICTOR_V domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing RICTOR_V domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the RICTOR_V domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a RICTOR_V domain which could be assigned to a KEGG orthologous group, and not all proteins containing RICTOR_V domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR029452
PfamRICTOR_V