The CHROMO domain within your query sequence starts at position 1 and ends at position 38, and its E-value is 1.2e-2.

IKWKGWSYIHSTWESEDSLQQQKVKGLKKLENFKKKED
CHROMO

CHROMO

Chromatin organization modifier domain
SMART ACC:SM000298
Description: -
InterPro ACC:IPR000953
InterPro abstract:

The CHROMO (CHRromatin Organization MOdifier) domain [ PUBMED:1982376 PUBMED:1708124 PUBMED:7667093 PUBMED:7501439 expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 41 552 CHROMO domains in 32 518 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing CHROMO domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing CHROMO domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Transport

Relevant references for this domain

Primary literature for the CHROMO domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a CHROMO domain which could be assigned to a KEGG orthologous group, and not all proteins containing CHROMO domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR000953
PROSITECHROMO_2
Pfamchromo